(data stored in ACNUC7421 zone)

EMBL: CP002355.PE157

CP002355.PE157       Location/Qualifiers
FT   CDS             161143..162444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0158"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653; KEGG: phe:Phep_3939
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PRIAM:
FT                   Glutamine--scyllo-inositol transaminase; SPTR: Aspartate
FT                   aminotransferase; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32825"
FT                   /db_xref="GOA:E4TXC8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC8"
FT                   /protein_id="ADR32825.1"
FT                   /translation="MKKLAINGGEKLRTTPFPAYNTIGIEEEEAVLRVLRSGKLSTFLG
FT                   TWHDDFFGGPEVRALESEWAAYFGVKHAISVNSATSGLYAAIGACGISPGDEVIVSAYT
FT                   MSASATAALVYGAIPIFADIEEDFYCLDVKSIETKITPRTKAIIVVDIFGQPYDVEAIN
FT                   TLAKKYNLFVIEDTAQAPGAMLGEKYAGTLGDIGVYSLNYHKHIHSGEGGIIVTDDDVL
FT                   ADKIRLIRNHAEAVLSARGIKDKSELINMVGYNYRMTEIEASIARCQLKKLPSLLTQRL
FT                   ENTAYFNEQLAQIPCIKPTKIREGAKHAFYVHPLQFDAEVAGMHRNRFIDAVKAELPPT
FT                   LLREESVVLLSYGYVKPLYLQPLYQEKIAFGRDGYPFNLSEVTYPKGLCPITEEMHFNR
FT                   LVTHEFMRPGMGKADMDDVVQAFVKVWDNRAELV"
     MKKLAINGGE KLRTTPFPAY NTIGIEEEEA VLRVLRSGKL STFLGTWHDD FFGGPEVRAL        60
     ESEWAAYFGV KHAISVNSAT SGLYAAIGAC GISPGDEVIV SAYTMSASAT AALVYGAIPI       120
     FADIEEDFYC LDVKSIETKI TPRTKAIIVV DIFGQPYDVE AINTLAKKYN LFVIEDTAQA       180
     PGAMLGEKYA GTLGDIGVYS LNYHKHIHSG EGGIIVTDDD VLADKIRLIR NHAEAVLSAR       240
     GIKDKSELIN MVGYNYRMTE IEASIARCQL KKLPSLLTQR LENTAYFNEQ LAQIPCIKPT       300
     KIREGAKHAF YVHPLQFDAE VAGMHRNRFI DAVKAELPPT LLREESVVLL SYGYVKPLYL       360
     QPLYQEKIAF GRDGYPFNLS EVTYPKGLCP ITEEMHFNRL VTHEFMRPGM GKADMDDVVQ       420
     AFVKVWDNRA ELV                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page