(data stored in ACNUC7421 zone)

EMBL: CP002355.PE158

CP002355.PE158       Location/Qualifiers
FT   CDS             162441..162983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0159"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   phe:Phep_3937 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: Acetyltransferase,
FT                   gnat family; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32826"
FT                   /db_xref="GOA:E4TXC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC9"
FT                   /protein_id="ADR32826.1"
FT                   /translation="MKFEGERVYLRPIELSDADGAYPLWLNDPDVCRYNSHGDTLYTKE
FT                   MAQSYIKSVMDNPSTAVFAICLRENDRHVGNIALQQISLKNRNAELAILIGDPSVHGKG
FT                   IGYEAGKLLVEYAFSTLKLHRLYCGTHEANIGMQKLALKLGMSEEGRRREALWKNGVLA
FT                   DIVEYGLLNTVSEKETL"
     MKFEGERVYL RPIELSDADG AYPLWLNDPD VCRYNSHGDT LYTKEMAQSY IKSVMDNPST        60
     AVFAICLREN DRHVGNIALQ QISLKNRNAE LAILIGDPSV HGKGIGYEAG KLLVEYAFST       120
     LKLHRLYCGT HEANIGMQKL ALKLGMSEEG RRREALWKNG VLADIVEYGL LNTVSEKETL       180
//

If you have problems or comments...

PBIL Back to PBIL home page