(data stored in ACNUC7421 zone)

EMBL: CP002355.PE159

CP002355.PE159       Location/Qualifiers
FT   CDS             162980..164113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0160"
FT                   /product="N-acetyl sugar amidotransferase"
FT                   /note="InterPro IPR020022; KEGG: tai:Taci_0673 LPS
FT                   biosynthesis protein; SPTR: LPS biosynthesis protein;
FT                   TIGRFAM: N-acetyl sugar amidotransferase; TIGRFAM: N-acetyl
FT                   sugar amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32827"
FT                   /db_xref="GOA:E4TXD0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD0"
FT                   /protein_id="ADR32827.1"
FT                   /translation="MTKQMIFTDTPPDNYGEPLYKEYLQYCTRCCMPSSNEGMQFDELG
FT                   ICLACRAQEQKMRINWKKSEEVLRETLESYKERSGDNYDCIIPISGGKDSVFQLHVLKK
FT                   VYGMKPLAVTFNHNWYSEIGRYNLENALEKLEIDHIMFTPNKALVKKLFVKSFYKIGDS
FT                   CWHCHAGVGAFPLQIAVKFNIPLLIWGESVCESSGRADFRDNVQKFDRDYFTKVSAKLY
FT                   PEQMIDEEITRKDLKPFELPSFEDIERVGVVGLHLGDYLFWDDERQMEFIKKEYDWREE
FT                   HRPGHYKGFKGNECKFETLHDHMKYVKRGFGRGTDQASADVRAGLLTREEGFEIAKKYD
FT                   QQRPAYLDEFLDMANITEEEYNNVLKAMRQGKFRECR"
     MTKQMIFTDT PPDNYGEPLY KEYLQYCTRC CMPSSNEGMQ FDELGICLAC RAQEQKMRIN        60
     WKKSEEVLRE TLESYKERSG DNYDCIIPIS GGKDSVFQLH VLKKVYGMKP LAVTFNHNWY       120
     SEIGRYNLEN ALEKLEIDHI MFTPNKALVK KLFVKSFYKI GDSCWHCHAG VGAFPLQIAV       180
     KFNIPLLIWG ESVCESSGRA DFRDNVQKFD RDYFTKVSAK LYPEQMIDEE ITRKDLKPFE       240
     LPSFEDIERV GVVGLHLGDY LFWDDERQME FIKKEYDWRE EHRPGHYKGF KGNECKFETL       300
     HDHMKYVKRG FGRGTDQASA DVRAGLLTRE EGFEIAKKYD QQRPAYLDEF LDMANITEEE       360
     YNNVLKAMRQ GKFRECR                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page