(data stored in ACNUC7421 zone)

EMBL: CP002355.PE16

CP002355.PE16        Location/Qualifiers
FT   CDS             complement(18133..18375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_2283 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2249)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32684"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW68"
FT                   /protein_id="ADR32684.1"
FT                   /translation="MILLDIREYDHPVPLEMAVNAFKKLSGDEIVHMIHRREPIPLFEI
FT                   IVKNDGRYLSVMEREDLWHIYFTRSSAVKLEHEHV"
     MILLDIREYD HPVPLEMAVN AFKKLSGDEI VHMIHRREPI PLFEIIVKND GRYLSVMERE        60
     DLWHIYFTRS SAVKLEHEHV                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page