(data stored in ACNUC7421 zone)

EMBL: CP002355.PE161

CP002355.PE161       Location/Qualifiers
FT   CDS             165466..166086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0162"
FT                   /product="pseudaminic acid biosynthesis-associated
FT                   methylase"
FT                   /note="InterPro IPR020027: IPR013217; KEGG: mhu:Mhun_3095
FT                   hypothetical protein; PFAM: Methyltransferase type 12;
FT                   SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   pseudaminic acid biosynthesis-associated methylase;
FT                   TIGRFAM: pseudaminic acid biosynthesis-associated
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32829"
FT                   /db_xref="GOA:E4TXD2"
FT                   /db_xref="InterPro:IPR020027"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD2"
FT                   /protein_id="ADR32829.1"
FT                   /translation="MSKFSTEQEKFWAGEFGDDYISRNRGENLIASNTVIFARLFQRIQ
FT                   KIESIIEFGANIGMNIHAIGNLLPKAYLSAVEINAVAVEHLKKIPDLNIYHQSILEFES
FT                   ERHYDLVFTKGVLIHIDPNELQNVYERMYKSSKRYIAMVEYHSPSPVELDYRGHKEKLF
FT                   KRDFAGELWEKYPDLTLLDYGFFYGRDPRHGQEDVNWFLFEKK"
     MSKFSTEQEK FWAGEFGDDY ISRNRGENLI ASNTVIFARL FQRIQKIESI IEFGANIGMN        60
     IHAIGNLLPK AYLSAVEINA VAVEHLKKIP DLNIYHQSIL EFESERHYDL VFTKGVLIHI       120
     DPNELQNVYE RMYKSSKRYI AMVEYHSPSP VELDYRGHKE KLFKRDFAGE LWEKYPDLTL       180
     LDYGFFYGRD PRHGQEDVNW FLFEKK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page