(data stored in ACNUC7421 zone)

EMBL: CP002355.PE162

CP002355.PE162       Location/Qualifiers
FT   CDS             166156..168156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0163"
FT                   /product="protein of unknown function DUF115"
FT                   /note="COGs: COG2604 conserved hypothetical protein;
FT                   InterPro IPR002826; KEGG: ant:Arnit_2922 hypothetical
FT                   protein; PFAM: protein of unknown function DUF115; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32830"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD3"
FT                   /protein_id="ADR32830.1"
FT                   /translation="MSAEIITEALNTFQKNLLFLERNYPELYERINLLNLLIEAEEYIE
FT                   RYALEYKEEGYFDVLELSSNELLYKENSYEHAKRVTEGVNFKRTGGIFYAQRLAAATDE
FT                   QAEYIDKSELSFHNVLWATIKIINYVKRYTSYETYMQSVDKIIFIGIGLGLYVESIADK
FT                   LKSQVVFIKEKNLEIFRLSLFVTDYEKLAVNRYLYFSITDDTEKERENFMPFLHKGNNH
FT                   NLYMKFIPFTLDYEEEVKRLQTHVFSQSYINYGYSPMLLRYIDSPRYLIREYSFLNIGR
FT                   YYVDNLFSKKPVLLLFSGPSTLKNIRWVQENSDRFIIVSALSTCRLLSSYNISPDVVMH
FT                   IDPGENTAALFEGLDIAEYFKNTVVILSANVDEATVQKFDKKSIHFIDQGTHYKRGFGT
FT                   LSAPSVGEYTYALFLILGAANMFLLGIDMALDSETLQSHGDFHPDQFTGKVDKENASLE
FT                   ASEAIEFVPGNFLEQVPTLAAYKLSIWQLEMFTDKFKQDYHRIYNLSNGALLQGCEPLR
FT                   IGEYDWGQWNVLDKKEIHQPLKDFFQSIGSTEFNEEDKGWIKYQIKTAKALEKIIKQHQ
FT                   KKKFAHPEAYLNSLTKLSIELSDMDYKTNSNLAQVYYEYFLIVLSYIYALFNTQELSNP
FT                   NKHVVQMHRMLDDQLLKISKTYLSKMESYLE"
     MSAEIITEAL NTFQKNLLFL ERNYPELYER INLLNLLIEA EEYIERYALE YKEEGYFDVL        60
     ELSSNELLYK ENSYEHAKRV TEGVNFKRTG GIFYAQRLAA ATDEQAEYID KSELSFHNVL       120
     WATIKIINYV KRYTSYETYM QSVDKIIFIG IGLGLYVESI ADKLKSQVVF IKEKNLEIFR       180
     LSLFVTDYEK LAVNRYLYFS ITDDTEKERE NFMPFLHKGN NHNLYMKFIP FTLDYEEEVK       240
     RLQTHVFSQS YINYGYSPML LRYIDSPRYL IREYSFLNIG RYYVDNLFSK KPVLLLFSGP       300
     STLKNIRWVQ ENSDRFIIVS ALSTCRLLSS YNISPDVVMH IDPGENTAAL FEGLDIAEYF       360
     KNTVVILSAN VDEATVQKFD KKSIHFIDQG THYKRGFGTL SAPSVGEYTY ALFLILGAAN       420
     MFLLGIDMAL DSETLQSHGD FHPDQFTGKV DKENASLEAS EAIEFVPGNF LEQVPTLAAY       480
     KLSIWQLEMF TDKFKQDYHR IYNLSNGALL QGCEPLRIGE YDWGQWNVLD KKEIHQPLKD       540
     FFQSIGSTEF NEEDKGWIKY QIKTAKALEK IIKQHQKKKF AHPEAYLNSL TKLSIELSDM       600
     DYKTNSNLAQ VYYEYFLIVL SYIYALFNTQ ELSNPNKHVV QMHRMLDDQL LKISKTYLSK       660
     MESYLE                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page