(data stored in ACNUC7421 zone)

EMBL: CP002355.PE163

CP002355.PE163       Location/Qualifiers
FT   CDS             complement(168199..170607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0164"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR010810: IPR001029; KEGG:
FT                   dat:HRM2_36880 putative flagellin; PFAM: flagellin domain
FT                   protein; flagellin hook IN repeat protein; SPTR: Putative
FT                   flagellin; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Flagellin hook IN motif; Bacterial flagellin
FT                   C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32831"
FT                   /db_xref="GOA:E4TXD4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD4"
FT                   /protein_id="ADR32831.1"
FT                   /translation="MGFRINTNIAAMTAHTSGVMNNRNLDESLSKLSSGLRINKAADDA
FT                   SGMVIANALRNQANSLGQAISNGNDAIGLIQTADGALNEYSKILDTIKTKAVQASSDGQ
FT                   NTSSRLAIQKDISRLMEELNTIAKTTSFNGQKLLSGSFTNKTIQMGASSNEGVNFSVAS
FT                   TEPNKIGHTSRAQLNLASEVGSVQLTMKSALTGENITMKAIDIQYNNTPENGMGALADE
FT                   INSHSGITGIRAKAVVEVTSGSAIAAGTTGSGFAINGINIGAINVKANDGDGALMAAIN
FT                   GKTTQTGVAATITDDGKITLKATDGRAIKVEGNVSDVFGGTANQLSTVGYIELVQKGAA
FT                   EFQVSGIGAGAVGGTINLSGATSMVKDSILAAGSSIAVGSTLKVGTTIGGDVNLTAATT
FT                   LVLDGTLKAGTTAAAGTTFAKGTTMGAAVNLTAAVALSADMYITAGSTLVSGTIFDAGT
FT                   LVQQDFTVNGVTYHKGDVLSSDVTLTASLTLTSDMTINVDLSGTANSSIATASTINVGS
FT                   VLGGNIVSSSTATVSEDMTLKSGSILAAASKLKAGSVLGADTVNSSAVTTYTTTDLKAG
FT                   SSLAAASTLKEGSTIGGTVINSSAITLNADMTIKAGSTLATGTVIKAGTVLMQDLTAAQ
FT                   TGASAMSAGDKVTVDITTGAAITLSADLTLLRGTGTAPTIAAGSTLMPNTENSGRVGID
FT                   AGEVTNLSSISVLNLTDAMKAIDTLDAAIGDLDTIRADLGSVQNQLTATINNISVTQVN
FT                   VKAAESQLRDVDFAAESANFSKFNILAQSGSYAMSQANAVQQNVLKLLQ"
     MGFRINTNIA AMTAHTSGVM NNRNLDESLS KLSSGLRINK AADDASGMVI ANALRNQANS        60
     LGQAISNGND AIGLIQTADG ALNEYSKILD TIKTKAVQAS SDGQNTSSRL AIQKDISRLM       120
     EELNTIAKTT SFNGQKLLSG SFTNKTIQMG ASSNEGVNFS VASTEPNKIG HTSRAQLNLA       180
     SEVGSVQLTM KSALTGENIT MKAIDIQYNN TPENGMGALA DEINSHSGIT GIRAKAVVEV       240
     TSGSAIAAGT TGSGFAINGI NIGAINVKAN DGDGALMAAI NGKTTQTGVA ATITDDGKIT       300
     LKATDGRAIK VEGNVSDVFG GTANQLSTVG YIELVQKGAA EFQVSGIGAG AVGGTINLSG       360
     ATSMVKDSIL AAGSSIAVGS TLKVGTTIGG DVNLTAATTL VLDGTLKAGT TAAAGTTFAK       420
     GTTMGAAVNL TAAVALSADM YITAGSTLVS GTIFDAGTLV QQDFTVNGVT YHKGDVLSSD       480
     VTLTASLTLT SDMTINVDLS GTANSSIATA STINVGSVLG GNIVSSSTAT VSEDMTLKSG       540
     SILAAASKLK AGSVLGADTV NSSAVTTYTT TDLKAGSSLA AASTLKEGST IGGTVINSSA       600
     ITLNADMTIK AGSTLATGTV IKAGTVLMQD LTAAQTGASA MSAGDKVTVD ITTGAAITLS       660
     ADLTLLRGTG TAPTIAAGST LMPNTENSGR VGIDAGEVTN LSSISVLNLT DAMKAIDTLD       720
     AAIGDLDTIR ADLGSVQNQL TATINNISVT QVNVKAAESQ LRDVDFAAES ANFSKFNILA       780
     QSGSYAMSQA NAVQQNVLKL LQ                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page