(data stored in ACNUC7421 zone)

EMBL: CP002355.PE164

CP002355.PE164       Location/Qualifiers
FT   CDS             complement(170830..173238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0165"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR010810: IPR001029; KEGG:
FT                   dat:HRM2_36880 putative flagellin; PFAM: flagellin domain
FT                   protein; flagellin hook IN repeat protein; SPTR: Putative
FT                   flagellin; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Flagellin hook IN motif; Bacterial flagellin
FT                   C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32832"
FT                   /db_xref="GOA:E4TXD5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD5"
FT                   /protein_id="ADR32832.1"
FT                   /translation="MGFRINTNISAMNAHSNSVMNNRNLDESLSKLSSGLRINKAADDA
FT                   SGMVIANALRNQANSLGQAISNGNDGIGLIQTADGALNEYSKILDTIKTKAVQASSDGQ
FT                   NTSSRLAIQKDINRLMEELNTIAKTTSFNGQKLLSGSFTNKTIQMGASSNEGVNFSVAS
FT                   AETNKIGHTSRATLNLASEVGSVQLTMKSALTGENITMKAIDIQYNNTPENGMGALADE
FT                   INSHSGITGIRAKAVVEVTSGSAIAAGATGTDFTINGINIGAINTKANDGDGALMAAIN
FT                   AKTAQTGVAATITDDGKMTLKSTDGRAIKVQGNVGDVFGGTANQLSTVGYIELVQKGAA
FT                   EFQVSGIGAGAVGGTINLSGATSMVKDSILAAGSSIAVGSTLKVGTTIGGDVNLSAATT
FT                   LVLDGTLKAGTTLLSATTFAKGTTTGAAFNTSAAVALSSDMFITAGSTLVSGSILDSGT
FT                   VVQQDFTVNGVTYSKGDTLTSDVTLTASLTLTSDMTINVDLSGTANSSIAAASTINVGS
FT                   VLGGNLVSSSSATVSEDMTLKSGSIIAAASKLKAGSVLGADTVNSSAVTTYTTTDLKAG
FT                   SSLAAASTLKEGSTIGGTVINSSAITLNSDMTIKAGSTLATGTVIKAGTVLTQDLTAAQ
FT                   TGAAAMSAGDKVTVDITTGAAITLSEDMTLLRGDGTAPTIAAGSTFMPNTENSGSVGID
FT                   AGEVTNLSSVSVLNLTDAMKAIDTLDAAIGDLDTIRADLGSVQNQLTATINNISVTQVN
FT                   VKAAESQLRDVDFAAESANFSKFNILAQSGSYAMSQANAVQQNVLRLLQ"
     MGFRINTNIS AMNAHSNSVM NNRNLDESLS KLSSGLRINK AADDASGMVI ANALRNQANS        60
     LGQAISNGND GIGLIQTADG ALNEYSKILD TIKTKAVQAS SDGQNTSSRL AIQKDINRLM       120
     EELNTIAKTT SFNGQKLLSG SFTNKTIQMG ASSNEGVNFS VASAETNKIG HTSRATLNLA       180
     SEVGSVQLTM KSALTGENIT MKAIDIQYNN TPENGMGALA DEINSHSGIT GIRAKAVVEV       240
     TSGSAIAAGA TGTDFTINGI NIGAINTKAN DGDGALMAAI NAKTAQTGVA ATITDDGKMT       300
     LKSTDGRAIK VQGNVGDVFG GTANQLSTVG YIELVQKGAA EFQVSGIGAG AVGGTINLSG       360
     ATSMVKDSIL AAGSSIAVGS TLKVGTTIGG DVNLSAATTL VLDGTLKAGT TLLSATTFAK       420
     GTTTGAAFNT SAAVALSSDM FITAGSTLVS GSILDSGTVV QQDFTVNGVT YSKGDTLTSD       480
     VTLTASLTLT SDMTINVDLS GTANSSIAAA STINVGSVLG GNLVSSSSAT VSEDMTLKSG       540
     SIIAAASKLK AGSVLGADTV NSSAVTTYTT TDLKAGSSLA AASTLKEGST IGGTVINSSA       600
     ITLNSDMTIK AGSTLATGTV IKAGTVLTQD LTAAQTGAAA MSAGDKVTVD ITTGAAITLS       660
     EDMTLLRGDG TAPTIAAGST FMPNTENSGS VGIDAGEVTN LSSVSVLNLT DAMKAIDTLD       720
     AAIGDLDTIR ADLGSVQNQL TATINNISVT QVNVKAAESQ LRDVDFAAES ANFSKFNILA       780
     QSGSYAMSQA NAVQQNVLRL LQ                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page