(data stored in ACNUC7421 zone)

EMBL: CP002355.PE165

CP002355.PE165       Location/Qualifiers
FT   CDS             complement(173337..174002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0166"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: glo:Glov_0968 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32833"
FT                   /db_xref="GOA:E4TXD6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD6"
FT                   /protein_id="ADR32833.1"
FT                   /translation="MRQGFMLIEVMLAIVMAGILAAVLATMGYYTVIQGNTLKQQNSKT
FT                   MLEVIRSRLLNTASNPDNDAYFELLKEVNATVPVVIGLGKDAWGRNISYTTYDFGTHNT
FT                   NATYADNNTTSISPNANVLGRLLSRGEDGILQTNATHSSAQGDDILLEIGIGETNHMKL
FT                   YNGSEVSTQTRGYNSAIVALSTDPYPASPINGTILFLRDTNVTKIYDSNTSDWIQISP"
     MRQGFMLIEV MLAIVMAGIL AAVLATMGYY TVIQGNTLKQ QNSKTMLEVI RSRLLNTASN        60
     PDNDAYFELL KEVNATVPVV IGLGKDAWGR NISYTTYDFG THNTNATYAD NNTTSISPNA       120
     NVLGRLLSRG EDGILQTNAT HSSAQGDDIL LEIGIGETNH MKLYNGSEVS TQTRGYNSAI       180
     VALSTDPYPA SPINGTILFL RDTNVTKIYD SNTSDWIQIS P                           221
//

If you have problems or comments...

PBIL Back to PBIL home page