(data stored in ACNUC7421 zone)

EMBL: CP002355.PE166

CP002355.PE166       Location/Qualifiers
FT   CDS             complement(174003..175043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0167"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR018076; KEGG: dat:HRM2_22330 PilC; PFAM:
FT                   Type II secretion system F domain; SPTR: Type II secretion
FT                   system protein; PFAM: Bacterial type II secretion system
FT                   protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32834"
FT                   /db_xref="GOA:E4TXD7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD7"
FT                   /protein_id="ADR32834.1"
FT                   /translation="MKPDVLTLLKALQLSLENGKSLTNALNLLQNTAKDKDERAIYINI
FT                   TRSIQEGASFSNAIEKYISPSPDIIQFVAMAEKGGGFVKTLKSVVNYLEIKNRFHQESN
FT                   DKIALPVIYFTLTAIIIIFIRFFAVPFHISEAKSYDPRIYAIIAEHLDMALILSNLLLG
FT                   GLLFFSAYFLIVMIALFNYSGAIQGVAKRIASHLPISSLVIGYFEKFILLSLLSEMLKN
FT                   GVSLKMTFKTAANSTIIPRISKQFEGILAQVSRGEKNFWSIPFFEEIEQHLLAGAGTVA
FT                   QLGNMFGEFADRARFNALTMASKFFRSMTIVAILLLSFAVFVEFFTIVLTQVLIQQGII
FT                   DQVGHA"
     MKPDVLTLLK ALQLSLENGK SLTNALNLLQ NTAKDKDERA IYINITRSIQ EGASFSNAIE        60
     KYISPSPDII QFVAMAEKGG GFVKTLKSVV NYLEIKNRFH QESNDKIALP VIYFTLTAII       120
     IIFIRFFAVP FHISEAKSYD PRIYAIIAEH LDMALILSNL LLGGLLFFSA YFLIVMIALF       180
     NYSGAIQGVA KRIASHLPIS SLVIGYFEKF ILLSLLSEML KNGVSLKMTF KTAANSTIIP       240
     RISKQFEGIL AQVSRGEKNF WSIPFFEEIE QHLLAGAGTV AQLGNMFGEF ADRARFNALT       300
     MASKFFRSMT IVAILLLSFA VFVEFFTIVL TQVLIQQGII DQVGHA                      346
//

If you have problems or comments...

PBIL Back to PBIL home page