(data stored in ACNUC7421 zone)

EMBL: CP002355.PE167

CP002355.PE167       Location/Qualifiers
FT   CDS             complement(175033..176595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0168"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482: IPR003593; KEGG: nam:NAMH_1148 type II secretion
FT                   system protein E; PFAM: type II secretion system protein E;
FT                   SMART: AAA ATPase; SPTR: Type II secretion system protein
FT                   E; PFAM: Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32835"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD8"
FT                   /protein_id="ADR32835.1"
FT                   /translation="MNIKKILTSKQLEVCQKEQYYYQQIGIKKHLLDIALSHHFIQKKE
FT                   TSKTYNLELMKEYEMIIADERDDTLTILRKELLGEKRLAELSGKVHKKIEQKNIPVREF
FT                   QQKYTSLLRVDPESIERKIKQFNAMDDGENEVIDIFEMLLEYGIQRSASDIHINAYESF
FT                   YWLRYRIDGKIIARYLLNHELAQRFALIIKERCNIDMINVYAPQGGSFSREYENRTIDF
FT                   RIEIAPSQYGENIVLRILDKASNIKSLNSLFPKSHPMSEHLHHFVNQSSGFFLVVGPTG
FT                   SGKTTTLNAILNQRDRLHEIIYTIEDPIEYKIDFVTQYQINEASGFTFAEGMKSIMRQD
FT                   PDVIVIGEMRDRESILTGLKAAHSGHMVFSTLHTPNSFMAMERIRDEGGDLFILAYSLS
FT                   GVVAQRLIPKLCSCKQPCGVEDGKAFFSTETYGFEKSGCIRCNFTGYSGRALLLDMVFI
FT                   PGDMKIRYQFYLALKNSTVFKAWEHFITFSYFQSAAYLFEMGTCDYETLSSELLSLGYV
FT                   HET"
     MNIKKILTSK QLEVCQKEQY YYQQIGIKKH LLDIALSHHF IQKKETSKTY NLELMKEYEM        60
     IIADERDDTL TILRKELLGE KRLAELSGKV HKKIEQKNIP VREFQQKYTS LLRVDPESIE       120
     RKIKQFNAMD DGENEVIDIF EMLLEYGIQR SASDIHINAY ESFYWLRYRI DGKIIARYLL       180
     NHELAQRFAL IIKERCNIDM INVYAPQGGS FSREYENRTI DFRIEIAPSQ YGENIVLRIL       240
     DKASNIKSLN SLFPKSHPMS EHLHHFVNQS SGFFLVVGPT GSGKTTTLNA ILNQRDRLHE       300
     IIYTIEDPIE YKIDFVTQYQ INEASGFTFA EGMKSIMRQD PDVIVIGEMR DRESILTGLK       360
     AAHSGHMVFS TLHTPNSFMA MERIRDEGGD LFILAYSLSG VVAQRLIPKL CSCKQPCGVE       420
     DGKAFFSTET YGFEKSGCIR CNFTGYSGRA LLLDMVFIPG DMKIRYQFYL ALKNSTVFKA       480
     WEHFITFSYF QSAAYLFEMG TCDYETLSSE LLSLGYVHET                             520
//

If you have problems or comments...

PBIL Back to PBIL home page