(data stored in ACNUC7421 zone)

EMBL: CP002355.PE168

CP002355.PE168       Location/Qualifiers
FT   CDS             complement(176636..177130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0169"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG: son:SO_3524
FT                   type IV pilus biogenesis protein PilE; SPTR: Type IV pilus
FT                   biogenesis protein PilE; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32836"
FT                   /db_xref="GOA:E4TXD9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD9"
FT                   /protein_id="ADR32836.1"
FT                   /translation="MKNKGFTLIEIAATIFLVGLLGAIGYFYLNTSSLTKSQYKSALQS
FT                   HMNLIESMVFQCKSLSEQFPKELNASVDASNTLLTELECNTSTPYSLDGGRNGFVPVSP
FT                   SGFNPYTATESGSAFYIMTSAENNSTQDKALKELILNYTSQQATLEHNLTSARFKFYLS
FT                   R"
     MKNKGFTLIE IAATIFLVGL LGAIGYFYLN TSSLTKSQYK SALQSHMNLI ESMVFQCKSL        60
     SEQFPKELNA SVDASNTLLT ELECNTSTPY SLDGGRNGFV PVSPSGFNPY TATESGSAFY       120
     IMTSAENNST QDKALKELIL NYTSQQATLE HNLTSARFKF YLSR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page