(data stored in ACNUC7421 zone)

EMBL: CP002355.PE169

CP002355.PE169       Location/Qualifiers
FT   CDS             complement(177133..177726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0170"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG:
FT                   vha:VIBHAR_03468 Tfp pilus assembly protein major pilin
FT                   PilA; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32837"
FT                   /db_xref="GOA:E4TXE0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE0"
FT                   /protein_id="ADR32837.1"
FT                   /translation="MTIYKNHRKGISLVEMTIAVILFGVLSTVTMLYYKNLFNIDLTSK
FT                   KARIAALMDQGRQLSGAYDVYIAQFGIAPLDVNLSDFNATNVMILKHLPKDIIEMTTVG
FT                   WELNTSAVDGHPAFQFPIDLNGTSYKLAGVKDDDQYCAIFNHEINTSLDLNVSDNMNFG
FT                   TAASQYSALGDAFCYTEILGANDHKHWIMIVQQN"
     MTIYKNHRKG ISLVEMTIAV ILFGVLSTVT MLYYKNLFNI DLTSKKARIA ALMDQGRQLS        60
     GAYDVYIAQF GIAPLDVNLS DFNATNVMIL KHLPKDIIEM TTVGWELNTS AVDGHPAFQF       120
     PIDLNGTSYK LAGVKDDDQY CAIFNHEINT SLDLNVSDNM NFGTAASQYS ALGDAFCYTE       180
     ILGANDHKHW IMIVQQN                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page