(data stored in ACNUC7421 zone)

EMBL: CP002355.PE17

CP002355.PE17        Location/Qualifiers
FT   CDS             complement(18372..18806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0017"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: tdn:Suden_0493 hemerythrin
FT                   HHE cation binding region; PFAM: Hemerythrin HHE cation
FT                   binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding region; PFAM: Hemerythrin HHE cation binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32685"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW69"
FT                   /protein_id="ADR32685.1"
FT                   /translation="MILEFMRDDHRACDHYYTEAENALSEKKVDDAVRLFDEFYRATNH
FT                   HFDMEERELFITFEKRTGMTGGPTQMMRYEHQQLRSLLESMKSALNEKRYNDFFGIGES
FT                   MMIMLQQHNMKEEQMLYPMIDRALGSDSEHMIQILKDMGQ"
     MILEFMRDDH RACDHYYTEA ENALSEKKVD DAVRLFDEFY RATNHHFDME ERELFITFEK        60
     RTGMTGGPTQ MMRYEHQQLR SLLESMKSAL NEKRYNDFFG IGESMMIMLQ QHNMKEEQML       120
     YPMIDRALGS DSEHMIQILK DMGQ                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page