(data stored in ACNUC7421 zone)

EMBL: CP002355.PE171

CP002355.PE171       Location/Qualifiers
FT   CDS             complement(178605..179207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0172"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG: emi:Emin_1442
FT                   Tfp pilus assembly protein major pilin PilA-like protein;
FT                   SPTR: Tfp pilus assembly protein major pilin PilA-like
FT                   protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32839"
FT                   /db_xref="GOA:E4TXE2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE2"
FT                   /protein_id="ADR32839.1"
FT                   /translation="MKQYTGMRKGISLIEMIVAVILFGVLSAIGVKYYKNFFNTELTAK
FT                   KARVAALLDQASQMSNAYDAYIVQVGSIANLDTNLTQLDDANVSILSRLPIAITELASG
FT                   NVDGTGGWELNKTTGISGTTGIALQYKLDKNATGRLNTSDDEQYCAIINHEFNASIEYN
FT                   ASNATVFPVSATSAYQRFGQVFCWNNGTHLTLFVVKP"
     MKQYTGMRKG ISLIEMIVAV ILFGVLSAIG VKYYKNFFNT ELTAKKARVA ALLDQASQMS        60
     NAYDAYIVQV GSIANLDTNL TQLDDANVSI LSRLPIAITE LASGNVDGTG GWELNKTTGI       120
     SGTTGIALQY KLDKNATGRL NTSDDEQYCA IINHEFNASI EYNASNATVF PVSATSAYQR       180
     FGQVFCWNNG THLTLFVVKP                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page