(data stored in ACNUC7421 zone)

EMBL: CP002355.PE172

CP002355.PE172       Location/Qualifiers
FT   CDS             complement(179250..179693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apr:Apre_1080 dihydroxyacetone kinase, DhaK
FT                   subunit; SPTR: Bacteriophage N4 receptor, outer membrane
FT                   protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32840"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE3"
FT                   /protein_id="ADR32840.1"
FT                   /translation="MKKYSLLGLFVVILLTILVSTYFYFLDIVYEDKTVAEEVKTFSAL
FT                   KTAVEQPVAVYAEQDVLRTKNDQYDAMLQELGMDAEVKIDQKKLTIQGGIHDTYSYLLL
FT                   KRLLDVVKNDDVELVSSCIGQGCTGDEFGFSITIRPYVLKIPQ"
     MKKYSLLGLF VVILLTILVS TYFYFLDIVY EDKTVAEEVK TFSALKTAVE QPVAVYAEQD        60
     VLRTKNDQYD AMLQELGMDA EVKIDQKKLT IQGGIHDTYS YLLLKRLLDV VKNDDVELVS       120
     SCIGQGCTGD EFGFSITIRP YVLKIPQ                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page