(data stored in ACNUC7421 zone)

EMBL: CP002355.PE173

CP002355.PE173       Location/Qualifiers
FT   CDS             complement(179680..180474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV2_1341 Mg-dependent DNase; SPTR:
FT                   Putative group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32841"
FT                   /db_xref="GOA:E4TXE4"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE4"
FT                   /protein_id="ADR32841.1"
FT                   /translation="MAIFTAGSISLTNDISNIRTQVYNYARQDLDSSAVKVSLRKHSEG
FT                   INYIAFLPKEKLVYENILLLASKNQGKSVIIFELDYKNVGVVVEDDKIIDYILDKPEDF
FT                   ATERGYGTLYADNTKGDKLVSINLDKERKDTWVGSFLLACTIVVTSGILYAGYGYLNAT
FT                   EINITNRDTLVKEYKELVTKNCQTSFAMTKKVDIVHELEKIENLTKETESTLQQISYQN
FT                   DSLCAEVVTPNLNAFVRLLPPEAKIIKEDVAQGIVQYCNEKI"
     MAIFTAGSIS LTNDISNIRT QVYNYARQDL DSSAVKVSLR KHSEGINYIA FLPKEKLVYE        60
     NILLLASKNQ GKSVIIFELD YKNVGVVVED DKIIDYILDK PEDFATERGY GTLYADNTKG       120
     DKLVSINLDK ERKDTWVGSF LLACTIVVTS GILYAGYGYL NATEINITNR DTLVKEYKEL       180
     VTKNCQTSFA MTKKVDIVHE LEKIENLTKE TESTLQQISY QNDSLCAEVV TPNLNAFVRL       240
     LPPEAKIIKE DVAQGIVQYC NEKI                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page