(data stored in ACNUC7421 zone)

EMBL: CP002355.PE174

CP002355.PE174       Location/Qualifiers
FT   CDS             complement(180477..181922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0175"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR004846; KEGG: mpt:Mpe_B0408 pilus (IV)
FT                   biogenesis; PFAM: type II and III secretion system protein;
FT                   SPTR: Pilus (IV) biogenesis; PFAM: Bacterial type II and
FT                   III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32842"
FT                   /db_xref="GOA:E4TXE5"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE5"
FT                   /protein_id="ADR32842.1"
FT                   /translation="MRSIILAAVLLGLTGCSVATKQETLTPEMHLKELDNPTTQIQRSE
FT                   PAVQVVEVKADNFHIEPQIIPDKEIIKRAKIMGAELSDVIALLTEATNENVVFQLQAES
FT                   VNSNKFSTSSSANGASNNEYTGKNDYLLTETTINLSASNISFGKILQKTVGDKLSILYD
FT                   DNTFYLGNLRTVTLKIPSINGLPEILKASITSMGASNVTTDAITSSVSFSAREKEYSDI
FT                   MKYLEILRNNLYVIEYEISIYDVELKDNYALGIDWSLVPSLAKDGLSFVASATGSLGSA
FT                   GASAVPLTFGMIMKNDTYNGKALVNALENFGKVESVQRPKLLGLAGTNVKLTDGVEAPY
FT                   ISGIQNTSVGNGTAQVSTTSATALSGLEINLKSNMLDGTVITDIGLKINDIVGYTSFEV
FT                   NGNKFSQPQTVTKAINNTMRVQPGVPIVISGLFRNKSDKGWNGLPGLGDSAAGVVGGAR
FT                   HTSNTKSEMVIVVTPRVIKYVMK"
     MRSIILAAVL LGLTGCSVAT KQETLTPEMH LKELDNPTTQ IQRSEPAVQV VEVKADNFHI        60
     EPQIIPDKEI IKRAKIMGAE LSDVIALLTE ATNENVVFQL QAESVNSNKF STSSSANGAS       120
     NNEYTGKNDY LLTETTINLS ASNISFGKIL QKTVGDKLSI LYDDNTFYLG NLRTVTLKIP       180
     SINGLPEILK ASITSMGASN VTTDAITSSV SFSAREKEYS DIMKYLEILR NNLYVIEYEI       240
     SIYDVELKDN YALGIDWSLV PSLAKDGLSF VASATGSLGS AGASAVPLTF GMIMKNDTYN       300
     GKALVNALEN FGKVESVQRP KLLGLAGTNV KLTDGVEAPY ISGIQNTSVG NGTAQVSTTS       360
     ATALSGLEIN LKSNMLDGTV ITDIGLKIND IVGYTSFEVN GNKFSQPQTV TKAINNTMRV       420
     QPGVPIVISG LFRNKSDKGW NGLPGLGDSA AGVVGGARHT SNTKSEMVIV VTPRVIKYVM       480
     K                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page