(data stored in ACNUC7421 zone)

EMBL: CP002355.PE175

CP002355.PE175       Location/Qualifiers
FT   CDS             complement(181922..182311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_2647 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32843"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE6"
FT                   /protein_id="ADR32843.1"
FT                   /translation="MNYFWSFLFLALSLNAAYNPFFREPVKPKKAPVATSDARPMPLPP
FT                   LLAPPSLPSKTEFDLSQLIYNCFLETNKGKFILLKIGENTVVLKEGDPFYANNHKYFIR
FT                   NITSNYITVDDAGRIQTIYFTTGAN"
     MNYFWSFLFL ALSLNAAYNP FFREPVKPKK APVATSDARP MPLPPLLAPP SLPSKTEFDL        60
     SQLIYNCFLE TNKGKFILLK IGENTVVLKE GDPFYANNHK YFIRNITSNY ITVDDAGRIQ       120
     TIYFTTGAN                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page