(data stored in ACNUC7421 zone)

EMBL: CP002355.PE176

CP002355.PE176       Location/Qualifiers
FT   CDS             182477..183022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0177"
FT                   /product="Peptidase M15A"
FT                   /note="COGs: COG3108 conserved hypothetical protein;
FT                   InterPro IPR013230; KEGG: rpf:Rpic12D_5086 protein of
FT                   unknown function DUF882; PFAM: Peptidase M15A; SPTR:
FT                   Putative uncharacterized protein; PFAM: Bacterial protein
FT                   of unknown function (DUF882)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32844"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE7"
FT                   /protein_id="ADR32844.1"
FT                   /translation="MEIKRLESPLLNPSRRTFIKNVIALSASTSLFADNKEKDEILSVI
FT                   RNGTSYKIPFIRDGKIEENGYDDLCRVFADVRAGVAVRMDPNLFLILTKAQQWLSSNHI
FT                   NRPIILTSGYRTEHTNSITEGAAFNSMHLYGKAADIKIEGIPADYLARLLRMCGGAGIG
FT                   IYPTFVHVDTWRERAWRG"
     MEIKRLESPL LNPSRRTFIK NVIALSASTS LFADNKEKDE ILSVIRNGTS YKIPFIRDGK        60
     IEENGYDDLC RVFADVRAGV AVRMDPNLFL ILTKAQQWLS SNHINRPIIL TSGYRTEHTN       120
     SITEGAAFNS MHLYGKAADI KIEGIPADYL ARLLRMCGGA GIGIYPTFVH VDTWRERAWR       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page