(data stored in ACNUC7421 zone)

EMBL: CP002355.PE177

CP002355.PE177       Location/Qualifiers
FT   CDS             183109..185331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0178"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="COGs: COG0550 Topoisomerase IA; InterProIPR000380:
FT                   IPR005733: IPR006171: IPR013497: IPR 013498: IPR006154:
FT                   IPR003601: IPR003602; KEGG: tdn:Suden_0171 DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain-containing protein; DNA
FT                   topoisomerase type IA zn finger domain protein; PRIAM: DNA
FT                   topoisomerase; SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; SPTR: DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: Toprim domain; Topoisomerase DNA
FT                   binding C4 zinc finger; DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32845"
FT                   /db_xref="GOA:E4TXE8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE8"
FT                   /protein_id="ADR32845.1"
FT                   /translation="MKLIIVESPAKAKTIKNFLSKDYEVIASKGHIRDLPKNRFGIKID
FT                   DEKIIAEYRISEDSTATVKQIQELAKKSDTIYIATDEDREGEAIGWHIAHAIDKDPSSL
FT                   PRIVFHEITKNAIIHALETPRTIDMDRVNAQQARRLLDRIVGYKLSPLLANKIQKGLSA
FT                   GRVQSSTLKIVVDREREIRAFIPEEYWTIDTLFKKDIEAALVNFENEKIDKLTIKTGDE
FT                   AARIVETLKGESFKVGEIETKERKSSTPPPFMTSTLQQTASSQLGFSPKKTMMVAQALY
FT                   EGVKTPEGTSGVITYMRTDSLNLATEAVEAAREVILTRYGKEYLPKEAKVYTKKSKGAQ
FT                   EAHEAIRPTMLGFTPEVAATYLKPDEIKLYRLIYNRFLACQMNDARFEQQSITFESAKA
FT                   QFRATGRKLLFDGFYRVTGSDDKDKLLPSLTTGDSIEIQTVTPEQHFTEPPARYSEASL
FT                   IKKLESEGIGRPSTYAPTISTLQARNYIEIEKRAIMPTEIAFTVTEMLENHFNEIVDAS
FT                   FTATMEETLDEISESGKSWHKILLDFYYPFIEKIDAGKSNIVSLKMAKPLGRNCPQCGS
FT                   ELLLRSGRFGEFIACSGFPKCKYTEQTEENQKENPATPDEVSEEVCDKCGSAMVVKNGR
FT                   NGKFLACSGYPKCKNTKTLNQETKFSQVPCPECGGKLLWRQSRRGAFWGCEHYPKCKFI
FT                   SKFEPSDKKCEVPGCGGALAPRTYRNKEVYECVKCKDRTPREEAGE"
     MKLIIVESPA KAKTIKNFLS KDYEVIASKG HIRDLPKNRF GIKIDDEKII AEYRISEDST        60
     ATVKQIQELA KKSDTIYIAT DEDREGEAIG WHIAHAIDKD PSSLPRIVFH EITKNAIIHA       120
     LETPRTIDMD RVNAQQARRL LDRIVGYKLS PLLANKIQKG LSAGRVQSST LKIVVDRERE       180
     IRAFIPEEYW TIDTLFKKDI EAALVNFENE KIDKLTIKTG DEAARIVETL KGESFKVGEI       240
     ETKERKSSTP PPFMTSTLQQ TASSQLGFSP KKTMMVAQAL YEGVKTPEGT SGVITYMRTD       300
     SLNLATEAVE AAREVILTRY GKEYLPKEAK VYTKKSKGAQ EAHEAIRPTM LGFTPEVAAT       360
     YLKPDEIKLY RLIYNRFLAC QMNDARFEQQ SITFESAKAQ FRATGRKLLF DGFYRVTGSD       420
     DKDKLLPSLT TGDSIEIQTV TPEQHFTEPP ARYSEASLIK KLESEGIGRP STYAPTISTL       480
     QARNYIEIEK RAIMPTEIAF TVTEMLENHF NEIVDASFTA TMEETLDEIS ESGKSWHKIL       540
     LDFYYPFIEK IDAGKSNIVS LKMAKPLGRN CPQCGSELLL RSGRFGEFIA CSGFPKCKYT       600
     EQTEENQKEN PATPDEVSEE VCDKCGSAMV VKNGRNGKFL ACSGYPKCKN TKTLNQETKF       660
     SQVPCPECGG KLLWRQSRRG AFWGCEHYPK CKFISKFEPS DKKCEVPGCG GALAPRTYRN       720
     KEVYECVKCK DRTPREEAGE                                                   740
//

If you have problems or comments...

PBIL Back to PBIL home page