(data stored in ACNUC7421 zone)

EMBL: CP002355.PE178

CP002355.PE178       Location/Qualifiers
FT   CDS             185328..185843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0179"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro IPR000979:
FT                   IPR004843; KEGG: tdn:Suden_0170 hypothetical protein; PFAM:
FT                   metallophosphoesterase; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: phosphodiesterase, MJ0936 family;
FT                   TIGRFAM: phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32846"
FT                   /db_xref="GOA:E4TXE9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE9"
FT                   /protein_id="ADR32846.1"
FT                   /translation="MKIGLLSDTHTKKGRSQKVIDHLKAQGAEFLIHAGDIVKPEILDQ
FT                   LKSSGLRYVAVYGNNDANLIEYHTRYNLVQEPHYFKLGGVNFKLMHLPFYMNADAEVII
FT                   FGHTHVFECDFKNRTLFLNPGEACARDKPYSSCAMLEITDNELKVTHYSRALESEYFEE
FT                   RHYTFERA"
     MKIGLLSDTH TKKGRSQKVI DHLKAQGAEF LIHAGDIVKP EILDQLKSSG LRYVAVYGNN        60
     DANLIEYHTR YNLVQEPHYF KLGGVNFKLM HLPFYMNADA EVIIFGHTHV FECDFKNRTL       120
     FLNPGEACAR DKPYSSCAML EITDNELKVT HYSRALESEY FEERHYTFER A                171
//

If you have problems or comments...

PBIL Back to PBIL home page