(data stored in ACNUC7421 zone)

EMBL: CP002355.PE179

CP002355.PE179       Location/Qualifiers
FT   CDS             185847..186695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0180"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="COGs: COG0502 Biotin synthase; InterPro IPR002684:
FT                   IPR007197: IPR010722: IPR006638; KEGG: tdn:Suden_0169
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; PRIAM: Biotin synthase;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Biotin
FT                   synthetase; TIGRFAM: biotin synthase; PFAM: Radical SAM
FT                   superfamily; Biotin and Thiamin Synthesis associated
FT                   domain; TIGRFAM: biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32847"
FT                   /db_xref="GOA:E4TXF0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF0"
FT                   /protein_id="ADR32847.1"
FT                   /translation="MKKIFLCSICNINSGTCNEDCKFCSQSVKYKADIERYRQKPMEQI
FT                   LEEARRLEALGALGFCLVTAQKGLDDKTLDFVCNVASTLKREVPRLRLIACNGTASFEQ
FT                   LNELRRAGVSAYNHNLETSREFYPQVCTTHPWDERYETCENVNRSGLKLISGGIFGMGE
FT                   TQEDRLSMLYSLKELNPISVPLNFYHHNAALPLNPSPLTIDESLELISLARKILDKADR
FT                   IMIAGGREITFKERQHEIFEAGANSIVIGNYLTTAGREAHADLMMLQDLGFEIAMTPED
FT                   K"
     MKKIFLCSIC NINSGTCNED CKFCSQSVKY KADIERYRQK PMEQILEEAR RLEALGALGF        60
     CLVTAQKGLD DKTLDFVCNV ASTLKREVPR LRLIACNGTA SFEQLNELRR AGVSAYNHNL       120
     ETSREFYPQV CTTHPWDERY ETCENVNRSG LKLISGGIFG MGETQEDRLS MLYSLKELNP       180
     ISVPLNFYHH NAALPLNPSP LTIDESLELI SLARKILDKA DRIMIAGGRE ITFKERQHEI       240
     FEAGANSIVI GNYLTTAGRE AHADLMMLQD LGFEIAMTPE DK                          282
//

If you have problems or comments...

PBIL Back to PBIL home page