(data stored in ACNUC7421 zone)

EMBL: CP002355.PE18

CP002355.PE18        Location/Qualifiers
FT   CDS             complement(18880..21708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0018"
FT                   /product="protein of unknown function DUF490"
FT                   /note="COGs: COG2911 conserved hypothetical protein;
FT                   InterPro IPR007452; KEGG: tdn:Suden_1135 hypothetical
FT                   protein; PFAM: protein of unknown function DUF490; SPTR:
FT                   Putative uncharacterized protein; PFAM: Family of unknown
FT                   function (DUF490)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32686"
FT                   /db_xref="GOA:E4TW70"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW70"
FT                   /protein_id="ADR32686.1"
FT                   /translation="MKRFWSLPWRKWFKHLFVTAHFLLYSSLLAASALLYIAFRPDGLE
FT                   IVNTYFLKPLGIRYTHAEGSLLDGFTLHNLRTDNARAKTFVLKYNLVKILEGEHTIDSV
FT                   QIDGLRLQLDDFKSDGTSIWPFPTFKLRDVTVTNLQLISSYSVELDLHGKNGTYDGDVI
FT                   NFSSLNATFKSRYASGAISGTVHQNSIRGMADIYPNSAELAPYSGRFTTLPRSLRIEIK
FT                   ELSNEKAILRTTIAALQSKQDPAVQAKAISLDFRYIYENDYLDIDALYTLIRGSDSMKT
FT                   KHHLRYALEGKTTTEFDGIITSNHPLPSNTLHGAFSDDTNGLSGTLTLDGSTLALASKD
FT                   YERFSWKLRSTHKNLRFIPSLPGALRSGSFELNGEGSYLLSSDSLKGTVDASHEDALFR
FT                   GIFSSRNGYRVLDGNLTLPGDAPLWKNWAHKPPEHLSISLNNEANATRLNLSGDALSFS
FT                   AVMQREKLKGSGNYLGTFFNVSGLLAPTQTRIDIDTFTPSVFATASELRPIELHKGEYY
FT                   DAEMRTKTRITLSDTLSIQSDIEIPWYAAVLDSQRAYGGTDGRVRLAYRDGNITVENYR
FT                   LEIANHPITTDKTSHLHINSAGGVTIDEFWIFDTLFLSGTVNSDLSAALRLHSDRFSYQ
FT                   GPERLAHASADMTFVRDAQANQTLSGVVNILDATITYLPFQEFKVMDDDIIIVQDVRPP
FT                   SSAKLSMNLRVTAAQPIRFKTKELDLRLDPDLTLWKEPTGPVQILGMITIPSGTAVSAG
FT                   KSFDIKHSEIYFGGDVPLNPYLNITIGHEVDYNKILIYVTHTLDSPIFLFSSDPVMSQN
FT                   DIMSYLLFGGPANTVSGGDSSTSTVRADATNFMLGAGLKGLINGATKLQIDTMNILTTA
FT                   EGGMGFEVGARLNKDLRVLYKNDTVSSVLIQYSLNRWLRLDADIHELGQGINAIYIKDF
FT                   RDFLPHNKPAKK"
     MKRFWSLPWR KWFKHLFVTA HFLLYSSLLA ASALLYIAFR PDGLEIVNTY FLKPLGIRYT        60
     HAEGSLLDGF TLHNLRTDNA RAKTFVLKYN LVKILEGEHT IDSVQIDGLR LQLDDFKSDG       120
     TSIWPFPTFK LRDVTVTNLQ LISSYSVELD LHGKNGTYDG DVINFSSLNA TFKSRYASGA       180
     ISGTVHQNSI RGMADIYPNS AELAPYSGRF TTLPRSLRIE IKELSNEKAI LRTTIAALQS       240
     KQDPAVQAKA ISLDFRYIYE NDYLDIDALY TLIRGSDSMK TKHHLRYALE GKTTTEFDGI       300
     ITSNHPLPSN TLHGAFSDDT NGLSGTLTLD GSTLALASKD YERFSWKLRS THKNLRFIPS       360
     LPGALRSGSF ELNGEGSYLL SSDSLKGTVD ASHEDALFRG IFSSRNGYRV LDGNLTLPGD       420
     APLWKNWAHK PPEHLSISLN NEANATRLNL SGDALSFSAV MQREKLKGSG NYLGTFFNVS       480
     GLLAPTQTRI DIDTFTPSVF ATASELRPIE LHKGEYYDAE MRTKTRITLS DTLSIQSDIE       540
     IPWYAAVLDS QRAYGGTDGR VRLAYRDGNI TVENYRLEIA NHPITTDKTS HLHINSAGGV       600
     TIDEFWIFDT LFLSGTVNSD LSAALRLHSD RFSYQGPERL AHASADMTFV RDAQANQTLS       660
     GVVNILDATI TYLPFQEFKV MDDDIIIVQD VRPPSSAKLS MNLRVTAAQP IRFKTKELDL       720
     RLDPDLTLWK EPTGPVQILG MITIPSGTAV SAGKSFDIKH SEIYFGGDVP LNPYLNITIG       780
     HEVDYNKILI YVTHTLDSPI FLFSSDPVMS QNDIMSYLLF GGPANTVSGG DSSTSTVRAD       840
     ATNFMLGAGL KGLINGATKL QIDTMNILTT AEGGMGFEVG ARLNKDLRVL YKNDTVSSVL       900
     IQYSLNRWLR LDADIHELGQ GINAIYIKDF RDFLPHNKPA KK                          942
//

If you have problems or comments...

PBIL Back to PBIL home page