(data stored in ACNUC7421 zone)

EMBL: CP002355.PE182

CP002355.PE182       Location/Qualifiers
FT   CDS             188124..188456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmu:TC0253 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32850"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF3"
FT                   /protein_id="ADR32850.1"
FT                   /translation="MYYVIQRHHGDPKKHYLAYTVPRYISSENSQNIIFEFRHNDTVKR
FT                   KWAPKEEIVLLTDNEQFFKETLEKLESLKRTHLERIGAAETQLNQEISAMLSTMQTEFE
FT                   TIKKNN"
     MYYVIQRHHG DPKKHYLAYT VPRYISSENS QNIIFEFRHN DTVKRKWAPK EEIVLLTDNE        60
     QFFKETLEKL ESLKRTHLER IGAAETQLNQ EISAMLSTMQ TEFETIKKNN                  110
//

If you have problems or comments...

PBIL Back to PBIL home page