(data stored in ACNUC7421 zone)

EMBL: CP002355.PE183

CP002355.PE183       Location/Qualifiers
FT   CDS             188533..189636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0184"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro IPR006664:
FT                   IPR006665: IPR003367; KEGG: tdn:Suden_2018 OmpA/MotB; PFAM:
FT                   OmpA/MotB domain protein; Thrombospondin type 3
FT                   repeat-containing protein; SPTR: OmpA/MotB; PFAM: OmpA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32851"
FT                   /db_xref="GOA:E4TXF4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF4"
FT                   /protein_id="ADR32851.1"
FT                   /translation="MKKLLFSSLLAATLLNASDYNYEVTPVVGYLWNSTANENTQSNRG
FT                   AMGGVDNHALYGLEMQMNNACDLIKPELSLLYGRDRADGETDKTGVLTTMLNGVYEMPT
FT                   DTAITPFAKAGVGYEWYTNTHPNDFDGMLLDAGLGLKAEITDRIALKLEGLYMYKMNRN
FT                   GSADGSNGEVHNVAALAGLTFSFDKKAAPVAAVAAPAVAEAVAPAPKAEAKPVPAPAPK
FT                   AVAPIDSDGDGVIDSLDKCPGTPKGFKVDADGCPLKATLHLNFATDSTKVDAEGAAKVA
FT                   EFASFLKESPAYKANIVGHTDSTASDAYNQKLSEKRAAKVKSMLIEDGVDSSRLTSEGM
FT                   GEKMPIASNKTKEGRAENRRIEVELCK"
     MKKLLFSSLL AATLLNASDY NYEVTPVVGY LWNSTANENT QSNRGAMGGV DNHALYGLEM        60
     QMNNACDLIK PELSLLYGRD RADGETDKTG VLTTMLNGVY EMPTDTAITP FAKAGVGYEW       120
     YTNTHPNDFD GMLLDAGLGL KAEITDRIAL KLEGLYMYKM NRNGSADGSN GEVHNVAALA       180
     GLTFSFDKKA APVAAVAAPA VAEAVAPAPK AEAKPVPAPA PKAVAPIDSD GDGVIDSLDK       240
     CPGTPKGFKV DADGCPLKAT LHLNFATDST KVDAEGAAKV AEFASFLKES PAYKANIVGH       300
     TDSTASDAYN QKLSEKRAAK VKSMLIEDGV DSSRLTSEGM GEKMPIASNK TKEGRAENRR       360
     IEVELCK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page