(data stored in ACNUC7421 zone)

EMBL: CP002355.PE186

CP002355.PE186       Location/Qualifiers
FT   CDS             190573..191241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_2504 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32854"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF7"
FT                   /protein_id="ADR32854.1"
FT                   /translation="MFRASILVLCLVSVSASAATILGFGAEADYYTPSASGDFDYKNTH
FT                   TRFGNNDESGYQIGLFVEHPVPVIPNVRIDFTPKTSFSGSDGIGGSSKVSVTQTDITPY
FT                   YEILDNAVEIDFGVSFKVLDATVEGTINESLNEVIPMGYLGVALTPPYSPIGMEGSVKY
FT                   VGYNGDSLTDARIKLVWKIGAGLGAQAGYRYESLKVSDHFDLNSDVTFKGPFVGFNYRF
FT                   "
     MFRASILVLC LVSVSASAAT ILGFGAEADY YTPSASGDFD YKNTHTRFGN NDESGYQIGL        60
     FVEHPVPVIP NVRIDFTPKT SFSGSDGIGG SSKVSVTQTD ITPYYEILDN AVEIDFGVSF       120
     KVLDATVEGT INESLNEVIP MGYLGVALTP PYSPIGMEGS VKYVGYNGDS LTDARIKLVW       180
     KIGAGLGAQA GYRYESLKVS DHFDLNSDVT FKGPFVGFNY RF                          222
//

If you have problems or comments...

PBIL Back to PBIL home page