(data stored in ACNUC7421 zone)

EMBL: CP002355.PE187

CP002355.PE187       Location/Qualifiers
FT   CDS             complement(191238..192305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0188"
FT                   /product="uncharacterized ATPase"
FT                   /note="InterPro IPR021115; KEGG: tdn:Suden_0284
FT                   uncharacterized ATPase; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32855"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF8"
FT                   /protein_id="ADR32855.1"
FT                   /translation="MNTLLDEYYRYDLHNAGFIERKYTIGDENTLIYGITQSGKTSLIK
FT                   NHLLSYKKSTYLYLDCRDVRLDTNDLNRSLKNFCRENKISILALDNYNEEIELFDMDQI
FT                   ILSSDKMLPIPFHTVQLELLDYEEFLAFETKFDSTALNHFFQLGGFPAMHRIPSEERVL
FT                   YLQNTLKNTLEPIEFSILAQASKMVTQKVSAFNLYERLKGERKISKDKLYLHLQSMYDR
FT                   GYLKSLEKFNHPSAVKKLYLCDIAIKHALVTQKHFGRLFENLVFSELDKHHIECYYDEG
FT                   IDFYLPHRRQIIIASPFANEHALFKKVEALEAFIVSNRIREVIVVTMNLESTLSHPVSR
FT                   IEMIPFEMWALGDDA"
     MNTLLDEYYR YDLHNAGFIE RKYTIGDENT LIYGITQSGK TSLIKNHLLS YKKSTYLYLD        60
     CRDVRLDTND LNRSLKNFCR ENKISILALD NYNEEIELFD MDQIILSSDK MLPIPFHTVQ       120
     LELLDYEEFL AFETKFDSTA LNHFFQLGGF PAMHRIPSEE RVLYLQNTLK NTLEPIEFSI       180
     LAQASKMVTQ KVSAFNLYER LKGERKISKD KLYLHLQSMY DRGYLKSLEK FNHPSAVKKL       240
     YLCDIAIKHA LVTQKHFGRL FENLVFSELD KHHIECYYDE GIDFYLPHRR QIIIASPFAN       300
     EHALFKKVEA LEAFIVSNRI REVIVVTMNL ESTLSHPVSR IEMIPFEMWA LGDDA            355
//

If you have problems or comments...

PBIL Back to PBIL home page