(data stored in ACNUC7421 zone)

EMBL: CP002355.PE188

CP002355.PE188       Location/Qualifiers
FT   CDS             192479..192790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0189"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="COGs: COG0051 Ribosomal protein S10; InterPro
FT                   IPR018268: IPR005731: IPR001848; KEGG: tdn:Suden_0285 30S
FT                   ribosomal protein S10; PFAM: ribosomal protein S10; SPTR:
FT                   30S ribosomal protein S10; TIGRFAM: ribosomal protein S10;
FT                   PFAM: Ribosomal protein S10p/S20e; TIGRFAM: ribosomal
FT                   protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32856"
FT                   /db_xref="GOA:E4TXF9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF9"
FT                   /protein_id="ADR32856.1"
FT                   /translation="MEKIRLKLRAYDHRVLDRSVASIVEAVKRTGAEIRGPIPLPTKIR
FT                   KYTVLKSPHVNKDSREQFEIRMHARLIDIVSATPDTVDSLMKLDLAPEVDVEVRSMDK"
     MEKIRLKLRA YDHRVLDRSV ASIVEAVKRT GAEIRGPIPL PTKIRKYTVL KSPHVNKDSR        60
     EQFEIRMHAR LIDIVSATPD TVDSLMKLDL APEVDVEVRS MDK                         103
//

If you have problems or comments...

PBIL Back to PBIL home page