(data stored in ACNUC7421 zone)

EMBL: CP002355.PE189

CP002355.PE189       Location/Qualifiers
FT   CDS             192801..193376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0190"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="COGs: COG0087 Ribosomal protein L3; InterPro
FT                   IPR019927: IPR000597; KEGG: wsu:WS1716 50S ribosomal
FT                   protein L3; PFAM: ribosomal protein L3; SPTR: 50S ribosomal
FT                   protein L3; TIGRFAM: 50S ribosomal protein L3; PFAM:
FT                   Ribosomal protein L3; TIGRFAM: 50S ribosomal protein L3,
FT                   bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32857"
FT                   /db_xref="GOA:E4TXG0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG0"
FT                   /protein_id="ADR32857.1"
FT                   /translation="MEYIVEKIGMSRTISVPSKVVTLLKVKEIKVCEVNDGVALVAYSQ
FT                   GKSTNKPVEGQQKKYNLSAEFNKFATLEVANTEAGDLDMAPLANATTVKSSFNTKGRGF
FT                   TGVMKRWNFAGGPGAHGHRFHRTGGSIGNREWPGKVQKGRKMSGQYGDEQVTVKNEVMS
FT                   YDAENGVLVVVGSIPGANGALGRVKVVK"
     MEYIVEKIGM SRTISVPSKV VTLLKVKEIK VCEVNDGVAL VAYSQGKSTN KPVEGQQKKY        60
     NLSAEFNKFA TLEVANTEAG DLDMAPLANA TTVKSSFNTK GRGFTGVMKR WNFAGGPGAH       120
     GHRFHRTGGS IGNREWPGKV QKGRKMSGQY GDEQVTVKNE VMSYDAENGV LVVVGSIPGA       180
     NGALGRVKVV K                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page