(data stored in ACNUC7421 zone)

EMBL: CP002355.PE19

CP002355.PE19        Location/Qualifiers
FT   CDS             complement(21705..23399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0019"
FT                   /product="surface antigen (D15)"
FT                   /note="COGs: COG0729 Outer membrane protein; InterPro
FT                   IPR010827: IPR000184; KEGG: tdn:Suden_1136 surface antigen
FT                   (D15); PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat-containing protein; SPTR: Surface
FT                   antigen (D15); PFAM: Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32687"
FT                   /db_xref="GOA:E4TW71"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW71"
FT                   /protein_id="ADR32687.1"
FT                   /translation="MRYGIVIALFCTALMSTPLPITFSGNEKISSDKLFGVLGLRKPYG
FT                   IEVWEDQPSIEPIAISQSVSALSSFYKSKGFYHARVTSETNENGVLFKIQENDPILVGT
FT                   VQINSPLDIKSAVSLHTDELFDQEEFSESKSLIKKRYGEAGYCNAQFNTKAWVDIETNR
FT                   AYLLFEATPGEACTFGKVSVESTSNIDGNLTASMLRFNEGDPYSVEAIKLSYEALYAQE
FT                   GISRVIINDNERNGSVVPISLNIEEAERPIRFTAGFGYSSDQGFAAQTGLKHRNFFGDL
FT                   KTLGLDFRYSQIKQEAAGSFGLPLQNRGLLGVDVGYKNEIFDGYKTESTYQKLTAKYQD
FT                   TPASAMMGFLFDQVKTYDSKDIATFPDNKLSLISPIGELNYDTRDKPLEPTKGYWLNAN
FT                   FMGSLYTPQLSDASYFKTLLSAAYITSIDEHVFGAKLKWGTLHVYDGAVPSSYRFYAGG
FT                   MNSNRAYTYRDLGPKNFDGDPIGFSSLTEGAFEYRFPIYQEFRGVLFTDVTFASQNTVP
FT                   DYAKDGYLGVGAGFRYVTPIGPVAIDFGFDPEDTSQYAIHFRIGELF"
     MRYGIVIALF CTALMSTPLP ITFSGNEKIS SDKLFGVLGL RKPYGIEVWE DQPSIEPIAI        60
     SQSVSALSSF YKSKGFYHAR VTSETNENGV LFKIQENDPI LVGTVQINSP LDIKSAVSLH       120
     TDELFDQEEF SESKSLIKKR YGEAGYCNAQ FNTKAWVDIE TNRAYLLFEA TPGEACTFGK       180
     VSVESTSNID GNLTASMLRF NEGDPYSVEA IKLSYEALYA QEGISRVIIN DNERNGSVVP       240
     ISLNIEEAER PIRFTAGFGY SSDQGFAAQT GLKHRNFFGD LKTLGLDFRY SQIKQEAAGS       300
     FGLPLQNRGL LGVDVGYKNE IFDGYKTEST YQKLTAKYQD TPASAMMGFL FDQVKTYDSK       360
     DIATFPDNKL SLISPIGELN YDTRDKPLEP TKGYWLNANF MGSLYTPQLS DASYFKTLLS       420
     AAYITSIDEH VFGAKLKWGT LHVYDGAVPS SYRFYAGGMN SNRAYTYRDL GPKNFDGDPI       480
     GFSSLTEGAF EYRFPIYQEF RGVLFTDVTF ASQNTVPDYA KDGYLGVGAG FRYVTPIGPV       540
     AIDFGFDPED TSQYAIHFRI GELF                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page