(data stored in ACNUC7421 zone)

EMBL: CP002355.PE190

CP002355.PE190       Location/Qualifiers
FT   CDS             193376..193987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0191"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="COGs: COG0088 Ribosomal protein L4; InterPro
FT                   IPR002136; KEGG: tdn:Suden_0287 50S ribosomal protein L4;
FT                   PFAM: ribosomal protein L4/L1e; SPTR: 50S ribosomal protein
FT                   L4; PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32858"
FT                   /db_xref="GOA:E4TXG1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG1"
FT                   /protein_id="ADR32858.1"
FT                   /translation="MSAIVLNEKFEKASEAALPESFSGINPHNLYLYVKSYQASIRANT
FT                   ASAKTRSMISGGGKKPWAQKGKGGARAGSRRSPIFVGGAIAHGPNTGRNYDQKINKKQK
FT                   KLALKCALDALAQAGKLFIVDTIEVPSGKTKDAKVLFDKLNVRDALLVKKILDENTYLA
FT                   FRNISSTYVVEENELNAFLAATYRSVVIEKAVWENLTKES"
     MSAIVLNEKF EKASEAALPE SFSGINPHNL YLYVKSYQAS IRANTASAKT RSMISGGGKK        60
     PWAQKGKGGA RAGSRRSPIF VGGAIAHGPN TGRNYDQKIN KKQKKLALKC ALDALAQAGK       120
     LFIVDTIEVP SGKTKDAKVL FDKLNVRDAL LVKKILDENT YLAFRNISST YVVEENELNA       180
     FLAATYRSVV IEKAVWENLT KES                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page