(data stored in ACNUC7421 zone)

EMBL: CP002355.PE191

CP002355.PE191       Location/Qualifiers
FT   CDS             193989..194270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0192"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="COGs: COG0089 Ribosomal protein L23; InterPro
FT                   IPR013025; KEGG: tdn:Suden_0288 50S ribosomal protein L23;
FT                   PFAM: Ribosomal protein L25/L23; SPTR: Ribosomal protein
FT                   L23; PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32859"
FT                   /db_xref="GOA:E4TXG2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG2"
FT                   /protein_id="ADR32859.1"
FT                   /translation="MADITDIKSILYTEKTLGLQEEGVIVVQTSPRMTKNALKEVFREY
FT                   FGIVPARVNSLNQDGKVKRFRGLAGKQNDFKKFYVKLPEGAQIDSLAV"
     MADITDIKSI LYTEKTLGLQ EEGVIVVQTS PRMTKNALKE VFREYFGIVP ARVNSLNQDG        60
     KVKRFRGLAG KQNDFKKFYV KLPEGAQIDS LAV                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page