(data stored in ACNUC7421 zone)

EMBL: CP002355.PE192

CP002355.PE192       Location/Qualifiers
FT   CDS             194272..195117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0193"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2; InterPro
FT                   IPR002171: IPR005880; KEGG: tdn:Suden_0289 50S ribosomal
FT                   protein L2; PFAM: ribosomal protein L2; SPTR: 50S ribosomal
FT                   protein L2; TIGRFAM: ribosomal protein L2; PFAM: Ribosomal
FT                   Proteins L2, RNA binding domain; Ribosomal Proteins L2,
FT                   C-terminal domain; TIGRFAM: ribosomal protein L2,
FT                   bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32860"
FT                   /db_xref="GOA:E4TXG3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG3"
FT                   /protein_id="ADR32860.1"
FT                   /translation="MAIKTYKPTTPSRRFYTNVDNSDITAKASVRSLLIKLPAAAGRNN
FT                   NGRITSRHKEAGAKKLYRIIDFKRNKFGVNGTVAAIEYDPYRNCRIALINYVDGDKRYI
FT                   LQPKGLVVGDVVAAAESGLDIKAGNAMKLMNIPVGTTVHNIELKPGKGGQIVRSAGTSA
FT                   QIMGREGKYVSLRLPSSEMRYVLGECMATVGTVGNEEYINIVLGKAGRTRHMGIRPQTR
FT                   GSAMNPIDHPHGGGEGKTNSGRHPVTPWGKPTKGAKTRKKKASDKLIITRRKPNAKRVG
FT                   "
     MAIKTYKPTT PSRRFYTNVD NSDITAKASV RSLLIKLPAA AGRNNNGRIT SRHKEAGAKK        60
     LYRIIDFKRN KFGVNGTVAA IEYDPYRNCR IALINYVDGD KRYILQPKGL VVGDVVAAAE       120
     SGLDIKAGNA MKLMNIPVGT TVHNIELKPG KGGQIVRSAG TSAQIMGREG KYVSLRLPSS       180
     EMRYVLGECM ATVGTVGNEE YINIVLGKAG RTRHMGIRPQ TRGSAMNPID HPHGGGEGKT       240
     NSGRHPVTPW GKPTKGAKTR KKKASDKLII TRRKPNAKRV G                           281
//

If you have problems or comments...

PBIL Back to PBIL home page