(data stored in ACNUC7421 zone)

EMBL: CP002355.PE193

CP002355.PE193       Location/Qualifiers
FT   CDS             195120..195401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0194"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="COGs: COG0185 Ribosomal protein S19; InterPro
FT                   IPR020934: IPR002222: IPR005732; KEGG: sdl:Sdel_1964
FT                   ribosomal protein S19; PFAM: ribosomal protein S19/S15;
FT                   SPTR: 30S ribosomal protein S19; TIGRFAM: ribosomal protein
FT                   S19; PFAM: Ribosomal protein S19; TIGRFAM: ribosomal
FT                   protein S19, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32861"
FT                   /db_xref="GOA:E4TXG4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG4"
FT                   /protein_id="ADR32861.1"
FT                   /translation="MARSVKKGPFVDGHLMKKVIAAKETKSNKPIKTWSRRSVVLPDMI
FT                   GLTFNVHNGRQFVPVFVTENHIGYKLGEFAPTRTFKGHKGSVQKKIGK"
     MARSVKKGPF VDGHLMKKVI AAKETKSNKP IKTWSRRSVV LPDMIGLTFN VHNGRQFVPV        60
     FVTENHIGYK LGEFAPTRTF KGHKGSVQKK IGK                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page