(data stored in ACNUC7421 zone)

EMBL: CP002355.PE194

CP002355.PE194       Location/Qualifiers
FT   CDS             195411..195728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0195"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="COGs: COG0091 Ribosomal protein L22; InterPro
FT                   IPR005727: IPR001063; KEGG: tdn:Suden_0291 50S ribosomal
FT                   protein L22; PFAM: ribosomal protein L22/L17; SPTR: 50S
FT                   ribosomal protein L22; TIGRFAM: ribosomal protein L22;
FT                   PFAM: Ribosomal protein L22p/L17e; TIGRFAM: ribosomal
FT                   protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32862"
FT                   /db_xref="GOA:E4TXG5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG5"
FT                   /protein_id="ADR32862.1"
FT                   /translation="MARALLKFVRVSPTKSRLIAREVQGMNAEQAMAALEFTPNKAAKI
FT                   IAKVVASAVANSGIDAQDCVIKSCRVDNGPVLKRFTQRARGTASGIRKPTAHILVEVEG
FT                   K"
     MARALLKFVR VSPTKSRLIA REVQGMNAEQ AMAALEFTPN KAAKIIAKVV ASAVANSGID        60
     AQDCVIKSCR VDNGPVLKRF TQRARGTASG IRKPTAHILV EVEGK                       105
//

If you have problems or comments...

PBIL Back to PBIL home page