(data stored in ACNUC7421 zone)

EMBL: CP002355.PE195

CP002355.PE195       Location/Qualifiers
FT   CDS             195731..196441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0196"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="COGs: COG0092 Ribosomal protein S3;
FT                   InterProIPR018280: IPR005704: IPR004088: IPR004044: IPR
FT                   008282: IPR001351: IPR004087; KEGG: tdn:Suden_0292 30S
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; Ribosomal protein S3 domain; KH type 2 domain
FT                   protein; SMART: KH domain protein; SPTR: 30S ribosomal
FT                   protein S3; TIGRFAM: ribosomal protein S3; PFAM: KH domain;
FT                   Ribosomal protein S3, C-terminal domain; Ribosomal protein
FT                   S3, N-terminal domain; TIGRFAM: ribosomal protein S3,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32863"
FT                   /db_xref="GOA:E4TXG6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG6"
FT                   /protein_id="ADR32863.1"
FT                   /translation="MGHKVNPIGLRLGINRNWESRWFPNFKTAAVSLGEDHKIRTYLKK
FT                   ELYYAGVSNIVIERTAKRLRVTIIAARPGIIIGKKGSDIEKIKESLQNLIGKPVAVNIK
FT                   EEKKAQASAQLVAENVATQLEKRVAFRRAMKKVMQNAQRAGAKGIKVSVAGRLGGAEIA
FT                   RTEWYLEGRVPLHTLRAKIDYGFAEAHTTYGVIGIKVWIFKGEVLTKGIQPEAKESKEE
FT                   RGEDQQRRPRRKAN"
     MGHKVNPIGL RLGINRNWES RWFPNFKTAA VSLGEDHKIR TYLKKELYYA GVSNIVIERT        60
     AKRLRVTIIA ARPGIIIGKK GSDIEKIKES LQNLIGKPVA VNIKEEKKAQ ASAQLVAENV       120
     ATQLEKRVAF RRAMKKVMQN AQRAGAKGIK VSVAGRLGGA EIARTEWYLE GRVPLHTLRA       180
     KIDYGFAEAH TTYGVIGIKV WIFKGEVLTK GIQPEAKESK EERGEDQQRR PRRKAN           236
//

If you have problems or comments...

PBIL Back to PBIL home page