(data stored in ACNUC7421 zone)

EMBL: CP002355.PE196

CP002355.PE196       Location/Qualifiers
FT   CDS             196444..196869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0197"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR020798: IPR000114: IPR016180; KEGG: tdn:Suden_0293 50S
FT                   ribosomal protein L16; PFAM: Ribosomal protein L10e/L16;
FT                   SPTR: 50S ribosomal protein L16; TIGRFAM: ribosomal protein
FT                   L16; PFAM: Ribosomal protein L16p/L10e; TIGRFAM: ribosomal
FT                   protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32864"
FT                   /db_xref="GOA:E4TXG7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG7"
FT                   /protein_id="ADR32864.1"
FT                   /translation="MLMPKRTKYRKMMKGRNRGYATNANKLDFGSIGFKATEAGRINSR
FT                   QIEAARIAANRHIKRQGKIWIRVFPAKPLTAKPLEVRMGKGKGSVDQWVMNIKPGRIIF
FT                   EMGGVEETLAREALSLAMQKLPFKTKIVTAEMSNEIY"
     MLMPKRTKYR KMMKGRNRGY ATNANKLDFG SIGFKATEAG RINSRQIEAA RIAANRHIKR        60
     QGKIWIRVFP AKPLTAKPLE VRMGKGKGSV DQWVMNIKPG RIIFEMGGVE ETLAREALSL       120
     AMQKLPFKTK IVTAEMSNEI Y                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page