(data stored in ACNUC7421 zone)

EMBL: CP002355.PE198

CP002355.PE198       Location/Qualifiers
FT   CDS             197052..197303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0199"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="COGs: COG0186 Ribosomal protein S17; InterPro
FT                   IPR019979: IPR019984: IPR000266; KEGG: abu:Abu_0761 30S
FT                   ribosomal protein S17; PFAM: ribosomal protein S17; SPTR:
FT                   30S ribosomal protein S17; TIGRFAM: 30S ribosomal protein
FT                   S17; PFAM: Ribosomal protein S17; TIGRFAM: 30S ribosomal
FT                   protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32866"
FT                   /db_xref="GOA:E4TXV3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV3"
FT                   /protein_id="ADR32866.1"
FT                   /translation="MTHKREIQGIVVTKAGEKTATIVVERRVMHPRYHKTVKRFKKYMI
FT                   HDENNQLNIGDEVIAIECRPLSKSKSFRLKTLVKGVNA"
     MTHKREIQGI VVTKAGEKTA TIVVERRVMH PRYHKTVKRF KKYMIHDENN QLNIGDEVIA        60
     IECRPLSKSK SFRLKTLVKG VNA                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page