(data stored in ACNUC7421 zone)

EMBL: CP002355.PE199

CP002355.PE199       Location/Qualifiers
FT   CDS             197300..197668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0200"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="COGs: COG0093 Ribosomal protein L14; InterPro
FT                   IPR019972: IPR005745: IPR000218; KEGG: cjd:JJD26997_2071
FT                   50S ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e; SPTR: 50S ribosomal protein L14; TIGRFAM:
FT                   ribosomal protein L14; PFAM: Ribosomal protein L14p/L23e;
FT                   TIGRFAM: ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32867"
FT                   /db_xref="GOA:E4TXV4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV4"
FT                   /protein_id="ADR32867.1"
FT                   /translation="MIQSFTRLAVADNTGAKELMCIKVLGGSKRRYATVGDVIIASVKK
FT                   AAPTGKIKKGQVVTAVVVRTKKEVHRENGSLIRFDENAAVILDKKREPIGTRIFGPVSR
FT                   EVRYAGFMKIVSLAPEVV"
     MIQSFTRLAV ADNTGAKELM CIKVLGGSKR RYATVGDVII ASVKKAAPTG KIKKGQVVTA        60
     VVVRTKKEVH RENGSLIRFD ENAAVILDKK REPIGTRIFG PVSREVRYAG FMKIVSLAPE       120
     VV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page