(data stored in ACNUC7421 zone)

EMBL: CP002355.PE2

CP002355.PE2         Location/Qualifiers
FT   CDS             1593..2660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tdn:Suden_0002
FT                   DNA polymerase III subunit beta; PFAM: DNA polymerase III
FT                   beta chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32670"
FT                   /db_xref="GOA:E4TW54"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW54"
FT                   /protein_id="ADR32670.1"
FT                   /translation="MKITVDKSVLENILLHLQPFLEKKDTSQITSHILLSTDGRTLYAK
FT                   ATDYEIGLIIQTNSVNVEEPGSLTANGKKLLDIIRILKDEEIELTLDKDTLHIRQKRSN
FT                   FKLPTYKSSEFPAFPTTDGKPNIAINSHLLIESLKKITPAADTNNPKFELNGALIDIKN
FT                   NQINFVSTDTRRLALVHIDSQNDHELSIIVPKKAIIEIQKLFADNIEIFYDNTHLVIKS
FT                   EDSLFYTKLINGKFPDYSRIIPKEAQRTIVLPKSVIVTAIKQITTISNDLKLTFQSDSI
FT                   LFESLSDDNIEAKTTVEIENGFESPFILAINSRYILDFLSQVNATEFTLEANESNQPFV
FT                   LKDQNFKTIVMPIVI"
     MKITVDKSVL ENILLHLQPF LEKKDTSQIT SHILLSTDGR TLYAKATDYE IGLIIQTNSV        60
     NVEEPGSLTA NGKKLLDIIR ILKDEEIELT LDKDTLHIRQ KRSNFKLPTY KSSEFPAFPT       120
     TDGKPNIAIN SHLLIESLKK ITPAADTNNP KFELNGALID IKNNQINFVS TDTRRLALVH       180
     IDSQNDHELS IIVPKKAIIE IQKLFADNIE IFYDNTHLVI KSEDSLFYTK LINGKFPDYS       240
     RIIPKEAQRT IVLPKSVIVT AIKQITTISN DLKLTFQSDS ILFESLSDDN IEAKTTVEIE       300
     NGFESPFILA INSRYILDFL SQVNATEFTL EANESNQPFV LKDQNFKTIV MPIVI            355
//

If you have problems or comments...

PBIL Back to PBIL home page