(data stored in ACNUC7421 zone)

EMBL: CP002355.PE201

CP002355.PE201       Location/Qualifiers
FT   CDS             197901..198446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0202"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132; KEGG: tdn:Suden_0298 50S ribosomal protein L5;
FT                   SPTR: 50S ribosomal protein L5; PFAM: ribosomal L5P family
FT                   C-terminus; Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32869"
FT                   /db_xref="GOA:E4TXV6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV6"
FT                   /protein_id="ADR32869.1"
FT                   /translation="MARLKDKYLALKPELQTTLGIANVMQVPALEKVIISVGCGFAMKD
FT                   NKLIQNIQDTISNIAGQRAMVVNARKSVAGFKVREGMPVGVKVTLRGAQMYDFMDKLIS
FT                   VSLPRVKDFRGIPRNGFDGRGNYNFGITEQLIFPEVDYDSIMQIHGMNITVVTSATADK
FT                   DAFKLLEMLGMPFAKGRE"
     MARLKDKYLA LKPELQTTLG IANVMQVPAL EKVIISVGCG FAMKDNKLIQ NIQDTISNIA        60
     GQRAMVVNAR KSVAGFKVRE GMPVGVKVTL RGAQMYDFMD KLISVSLPRV KDFRGIPRNG       120
     FDGRGNYNFG ITEQLIFPEV DYDSIMQIHG MNITVVTSAT ADKDAFKLLE MLGMPFAKGR       180
     E                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page