(data stored in ACNUC7421 zone)

EMBL: CP002355.PE202

CP002355.PE202       Location/Qualifiers
FT   CDS             198461..198631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0203"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="COGs: COG0199 Ribosomal protein S14; InterPro
FT                   IPR018271: IPR001209; KEGG: tdn:Suden_0299 30S ribosomal
FT                   protein S14; PFAM: ribosomal protein S14; SPTR: 30S
FT                   ribosomal protein S14 type Z; manually curated; PFAM:
FT                   Ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32870"
FT                   /db_xref="GOA:E4TXV7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV7"
FT                   /protein_id="ADR32870.1"
FT                   /translation="MIAKAARTPKFAVRAYTRCQICGRPHSVISDFGICRVCFRKMANE
FT                   GLIPGVRKSSW"
     MIAKAARTPK FAVRAYTRCQ ICGRPHSVIS DFGICRVCFR KMANEGLIPG VRKSSW            56
//

If you have problems or comments...

PBIL Back to PBIL home page