(data stored in ACNUC7421 zone)

EMBL: CP002355.PE203

CP002355.PE203       Location/Qualifiers
FT   CDS             198674..199069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0204"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="COGs: COG0096 Ribosomal protein S8; InterPro
FT                   IPR000630; KEGG: tdn:Suden_0300 30S ribosomal protein S8;
FT                   PFAM: ribosomal protein S8; SPTR: 30S ribosomal protein S8;
FT                   PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32871"
FT                   /db_xref="GOA:E4TXV8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV8"
FT                   /protein_id="ADR32871.1"
FT                   /translation="MINDLIADSLTRIRNAAMRRLDSTTLVHSKVVEAVVAILADKGYI
FT                   ESFNVVEDGVKKTINVVLKYDEKGRTVINEVKRVSKPGRRVYKGKDELKRFKNGYGTII
FT                   VSSSKGVLPNDKAFELGVGGEVLCTIW"
     MINDLIADSL TRIRNAAMRR LDSTTLVHSK VVEAVVAILA DKGYIESFNV VEDGVKKTIN        60
     VVLKYDEKGR TVINEVKRVS KPGRRVYKGK DELKRFKNGY GTIIVSSSKG VLPNDKAFEL       120
     GVGGEVLCTI W                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page