(data stored in ACNUC7421 zone)

EMBL: CP002355.PE204

CP002355.PE204       Location/Qualifiers
FT   CDS             199079..199615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0205"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="COGs: COG0097 Ribosomal protein L6P/L9E; InterPro
FT                   IPR002358: IPR000702: IPR019906: IPR020040; KEGG:
FT                   tdn:Suden_0301 50S ribosomal protein L6; PFAM: Ribosomal
FT                   protein L6, alpha-beta domain; SPTR: LSU ribosomal protein
FT                   L6P; TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein
FT                   L6; TIGRFAM: ribosomal protein L6, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32872"
FT                   /db_xref="GOA:E4TXV9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV9"
FT                   /protein_id="ADR32872.1"
FT                   /translation="MSRIGKLPISIPADVKATLEGTVLTFTKGATTQTLDTLGNCGVAL
FT                   DGNTLTFSTNSDQRTDRAFWGTYRALAANIITGLTTGFEKKLEINGVGYRAAVNGNVLN
FT                   LQLGFSHDINYDIPAGISMAVEKNVISIKGADKQQVGQIAAEIRSFRPPEPYKGKGVKY
FT                   SDETILRKAGKTSKK"
     MSRIGKLPIS IPADVKATLE GTVLTFTKGA TTQTLDTLGN CGVALDGNTL TFSTNSDQRT        60
     DRAFWGTYRA LAANIITGLT TGFEKKLEIN GVGYRAAVNG NVLNLQLGFS HDINYDIPAG       120
     ISMAVEKNVI SIKGADKQQV GQIAAEIRSF RPPEPYKGKG VKYSDETILR KAGKTSKK         178
//

If you have problems or comments...

PBIL Back to PBIL home page