(data stored in ACNUC7421 zone)

EMBL: CP002355.PE205

CP002355.PE205       Location/Qualifiers
FT   CDS             199627..199983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0206"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR004389: IPR005484; KEGG: tdn:Suden_0302 50S ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E; SPTR: 50S
FT                   ribosomal protein L18; TIGRFAM: ribosomal protein L18;
FT                   PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein
FT                   L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32873"
FT                   /db_xref="GOA:E4TXW0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW0"
FT                   /protein_id="ADR32873.1"
FT                   /translation="MTGKTLKNKSAKRLQRKRRIRSKISGCASLPRVSIFRSNRYISAQ
FT                   AINDEAAVTLAAVHSKTLGLKANKADAEKAAAVFAKNLKDAGISEVTFDRNGFLYHGVV
FT                   KAFAEALRANEIKF"
     MTGKTLKNKS AKRLQRKRRI RSKISGCASL PRVSIFRSNR YISAQAINDE AAVTLAAVHS        60
     KTLGLKANKA DAEKAAAVFA KNLKDAGISE VTFDRNGFLY HGVVKAFAEA LRANEIKF         118
//

If you have problems or comments...

PBIL Back to PBIL home page