(data stored in ACNUC7421 zone)

EMBL: CP002355.PE206

CP002355.PE206       Location/Qualifiers
FT   CDS             199993..200436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0207"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5; InterPro
FT                   IPR018192: IPR005712: IPR013810: IPR005324; KEGG:
FT                   tdn:Suden_0303 30S ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5; ribosomal protein S5 domain protein; SPTR: 30S
FT                   ribosomal protein S5; TIGRFAM: ribosomal protein S5; PFAM:
FT                   Ribosomal protein S5, N-terminal domain; Ribosomal protein
FT                   S5, C-terminal domain; TIGRFAM: ribosomal protein S5,
FT                   bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32874"
FT                   /db_xref="GOA:E4TXW1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW1"
FT                   /protein_id="ADR32874.1"
FT                   /translation="MQAINREEFSEAIVNIGRVTKVVKGGRRFRFTALVVVGNKKGTVG
FT                   YGVGKAKEVPDAIRKAVDEAFKNLTEVKIKGTTIAHDIEVKYNASRILLKPASEGTGVI
FT                   AGGATRPVLELAGIQDILTKSLGSNNPNTVVRATIDALSRIKG"
     MQAINREEFS EAIVNIGRVT KVVKGGRRFR FTALVVVGNK KGTVGYGVGK AKEVPDAIRK        60
     AVDEAFKNLT EVKIKGTTIA HDIEVKYNAS RILLKPASEG TGVIAGGATR PVLELAGIQD       120
     ILTKSLGSNN PNTVVRATID ALSRIKG                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page