(data stored in ACNUC7421 zone)

EMBL: CP002355.PE207

CP002355.PE207       Location/Qualifiers
FT   CDS             200440..200838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0208"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="COGs: COG0200 Ribosomal protein L15; InterPro
FT                   IPR005749; KEGG: ccv:CCV52592_1015 50S ribosomal protein
FT                   L15; SPTR: 50S ribosomal protein L15; TIGRFAM: ribosomal
FT                   protein L15; PFAM: Ribosomal protein L18e/L15; TIGRFAM:
FT                   ribosomal protein L15, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32875"
FT                   /db_xref="GOA:E4TXW2"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW2"
FT                   /protein_id="ADR32875.1"
FT                   /translation="MALENLTPAEGSTHSKKRLGRGQGSGQGKTAGKGHKGQKARKGYN
FT                   EKRNFEGGQQPLARRLPKFGFTSRVVKPTTINVEKVKEIAALSEITMETIRSVHRLAKS
FT                   VVSVKLVGASAKDLASKIKDENVTTTGN"
     MALENLTPAE GSTHSKKRLG RGQGSGQGKT AGKGHKGQKA RKGYNEKRNF EGGQQPLARR        60
     LPKFGFTSRV VKPTTINVEK VKEIAALSEI TMETIRSVHR LAKSVVSVKL VGASAKDLAS       120
     KIKDENVTTT GN                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page