(data stored in ACNUC7421 zone)

EMBL: CP002355.PE208

CP002355.PE208       Location/Qualifiers
FT   CDS             200838..202100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0209"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: tdn:Suden_0305 preprotein
FT                   translocase subunit SecY; PFAM: SecY protein; SPTR:
FT                   Preprotein translocase subunit secY; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32876"
FT                   /db_xref="GOA:E4TXW3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW3"
FT                   /protein_id="ADR32876.1"
FT                   /translation="MNQQLVNKILITIGFLFIYRLLAYVPVPGVDTAVIASFFNSHQAD
FT                   ALGLFNMFSGNAVERLSIISLGIMPYITASIIMELLAATFPNLAQMKKERDGMVKYMQI
FT                   IRYATIVITIVQAIGVSVGLQSMTGQDGASAILVDHSTFVTLAVVSMLAGTMLLMWIGE
FT                   QITQSGIGNGVSLIIFAGIVSAIPSAISQAVTMVNTGAMGFLSLLGIIALIIATILVII
FT                   YVELGERRIPVTYAKKTMMQNQNKRVMNYIPVKVNLSGVIPVIFASAILMFPMTVMSSS
FT                   TNPTVQAIADVLNPNHYFFNFLTFLFVVFFAFFYASIVFNAKDISENLKRQGGFIPGVR
FT                   PGESTKEFLNDTAGRLTITGAIYLGLIATLPWVIVKAMGVPFFFGGTAVLIVVQVALDT
FT                   MRRIEAQVYMSKYQTLSAVGL"
     MNQQLVNKIL ITIGFLFIYR LLAYVPVPGV DTAVIASFFN SHQADALGLF NMFSGNAVER        60
     LSIISLGIMP YITASIIMEL LAATFPNLAQ MKKERDGMVK YMQIIRYATI VITIVQAIGV       120
     SVGLQSMTGQ DGASAILVDH STFVTLAVVS MLAGTMLLMW IGEQITQSGI GNGVSLIIFA       180
     GIVSAIPSAI SQAVTMVNTG AMGFLSLLGI IALIIATILV IIYVELGERR IPVTYAKKTM       240
     MQNQNKRVMN YIPVKVNLSG VIPVIFASAI LMFPMTVMSS STNPTVQAIA DVLNPNHYFF       300
     NFLTFLFVVF FAFFYASIVF NAKDISENLK RQGGFIPGVR PGESTKEFLN DTAGRLTITG       360
     AIYLGLIATL PWVIVKAMGV PFFFGGTAVL IVVQVALDTM RRIEAQVYMS KYQTLSAVGL       420
//

If you have problems or comments...

PBIL Back to PBIL home page