(data stored in ACNUC7421 zone)

EMBL: CP002355.PE210

CP002355.PE210       Location/Qualifiers
FT   CDS             202872..203090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0211"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR004368: IPR006196; KEGG: tdn:Suden_0307
FT                   translation initiation factor IF-1; PFAM: S1 IF1 family
FT                   protein; SPTR: Translation initiation factor IF-1; TIGRFAM:
FT                   translation initiation factor IF-1; PFAM: Translation
FT                   initiation factor 1A / IF-1; TIGRFAM: translation
FT                   initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32878"
FT                   /db_xref="GOA:E4TXW5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW5"
FT                   /protein_id="ADR32878.1"
FT                   /translation="MAKDDVIEVDGKIIEALPNATFRVELPNGHVILCHIAGKMRMHYI
FT                   KILPGDTVKIELTPYSLDKGRITYRYK"
     MAKDDVIEVD GKIIEALPNA TFRVELPNGH VILCHIAGKM RMHYIKILPG DTVKIELTPY        60
     SLDKGRITYR YK                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page